PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1507s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 420aa    MW: 45475.6 Da    PI: 8.0009
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1507s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32229284156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Kalax.1507s0001.1.p 229 KQRRCWSPELHRRFIHALQQLGGPHVATPKQIKELMKVDGLTNDEVKSHLQKYRLH 284
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-28226287IPR009057Homeodomain-like
SuperFamilySSF466892.15E-18226287IPR009057Homeodomain-like
PROSITE profilePS5129415.314226286IPR017930Myb domain
TIGRFAMsTIGR015572.4E-27229284IPR006447Myb domain, plants
PfamPF002497.0E-8231282IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MRRTHLAYNQ STAPALDPAP ARKDRVLWSF YDLGVMDYAD KMQKCSEYVE ALEVERRKIQ  60
VFQRELPLCL ELVSQAIDAC RQQLSSASPP HAAAVGASHE CFHVRQQSEC SEQTSSHGPV  120
LEEFIPIKRA ASCSSEDVGD EEEDESGEKS GDKSGKKSDW LRSVQLWNQS PDPAPVCEVK  180
KNGGAFRPFS KEKAVVVAEM VDKPASSTTL KSRKEESAKE KESGQTQRKQ RRCWSPELHR  240
RFIHALQQLG GPHVATPKQI KELMKVDGLT NDEVKSHLQK YRLHMRRPSA TMASNANAQG  300
PQFVVVGGIW VPPPEYAAPA MTPAATTSSG DPPEADNGKR EARTPSNGVY APVATVGTPF  360
ARPASRTQNS NQKVQSGSHC EDDNGSHSAH GGARAHSGSP ASSSSTHTTA TATASPASS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-129PREDICTED: probable transcription factor GLK2
TrEMBLA0A0J8B7X91e-126A0A0J8B7X9_BETVU; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-125(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.15e-91G2-like family protein